SCOPe 2.07: Domain d4mi4c_: 4mi4 C:

Lineage for d4mi4c_ (4mi4 C:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
   3 layers: a/b/a; contains mixed beta-sheet

4. Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families)

5. Family d.108.1.0: automated matches [191308] (1 protein)
   not a true family

6. Protein automated matches [190038] (48 species)
   not a true protein

7. Species Vibrio cholerae [TaxId:666] [188612] (22 PDB entries)

8. Domain d4mi4c_: 4mi4 C: [235642]
   automated match to d4mi4a_
   complexed with spm

Details for d4mi4c_

PDB Entry: 4mi4, 1.85 Å

PDB Description: crystal structure of spermidine n-acetyltransferase from vibrio cholerae in complex with spermine

PDB Compounds: (C:) Spermidine n1-acetyltransferase

SCOPe Domain Sequences for d4mi4c_:

Sequence; same for both SEQRES and ATOM records:

>d4mi4c_ d.108.1.0 (C:) automated matches {Vibrio cholerae [TaxId: 666]}
qltlralergdlrfihnlnnnrnimsywfeepyesfdeleelynkhihdnaerrfvveda
qknliglvelieinyihrsaefqiiiapehqgkgfartlinraldysftilnlhkiylhv
avenpkavhlyeecgfveeghlveeffingryqdvkrmyilqskylnrse

Timeline for d4mi4c_:

• d4mi4c_ first appeared in SCOPe 2.03
  
• d4mi4c_ appears in SCOPe 2.06
  
• d4mi4c_ appears in the current release, SCOPe 2.08