Lineage for d4mhba_ (4mhb A:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1565956Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1568069Superfamily c.1.7: NAD(P)-linked oxidoreductase [51430] (2 families) (S)
  5. 1568070Family c.1.7.1: Aldo-keto reductases (NADP) [51431] (16 proteins)
    Common fold covers whole protein structure
  6. 1568369Protein automated matches [190169] (5 species)
    not a true protein
  7. 1568487Species Yersinia pestis [TaxId:632] [228396] (1 PDB entry)
  8. 1568488Domain d4mhba_: 4mhb A: [235632]
    automated match to d4mhbd_
    complexed with so4

Details for d4mhba_

PDB Entry: 4mhb (more details), 1.75 Å

PDB Description: Structure of a putative reductase from Yersinia pestis
PDB Compounds: (A:) Putative aldo/keto reductase

SCOPe Domain Sequences for d4mhba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4mhba_ c.1.7.1 (A:) automated matches {Yersinia pestis [TaxId: 632]}
mqtvklnngiampllgfgvfqmtntaeceravidaietgyrlidtaasyqnetqvgnalk
lsgiardelfittklwlqdtyyegakaqferslnrlqldyvdlylihqpygdvhgawram
eelhqagkiraigvsnfhpdrladlmafnkiipavnqievnpfnqqlhavpwmqsrgiqp
eawapfaegrnglfqnpvltaigekygksvgqvvlrwifqrgivslaksvrkgrmeenin
ildfelsaedmlqiaaldtatsaffshrdpamvewltgrkldv

SCOPe Domain Coordinates for d4mhba_:

Click to download the PDB-style file with coordinates for d4mhba_.
(The format of our PDB-style files is described here.)

Timeline for d4mhba_: