SCOP 1.63: Domain d1mec2_: 1mec 2:

Lineage for d1mec2_ (1mec 2:)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.10: Viral coat and capsid proteins [49610] (1 superfamily)
   sandwich; 8 strands in 2 sheets; jelly-roll
   variations: some members have additional 1-2 strands

4. Superfamily b.10.1: Viral coat and capsid proteins [49611] (4 families)

5. Family b.10.1.4: Animal virus proteins [49656] (18 proteins)
   mammalian viruses

6. Protein Mengo virus [49678] (1 species)

7. Species Host: monkey brain; middle size plaque variant [49679] (2 PDB entries)

8. Domain d1mec2_: 1mec 2: [23562]

Details for d1mec2_

PDB Entry: 1mec, 3.2 Å

PDB Description: conformational variability of a picornavirus capsid: ph-dependent structural changes of mengo virus related to its host receptor attachment site and disassembly

SCOP Domain Sequences for d1mec2_:

Sequence; same for both SEQRES and ATOM records:

>d1mec2_ b.10.1.4 (2:) Mengo virus {Host: monkey brain; middle size plaque variant}
dqnteemenlsdrvsqdtagntvtntqstvgrlvgygtvhdgehpascadtasekilave
ryytfkvndwtstqkpfeyiriplphvlsgedggvfgatlrrhylvktgwrvqvqcnasq
fhagsllvfmapeyptldvfamdnrwskdnlpngtrtqtnrkgpfamdhqnfwqwtlyph
qflnlrtnttvdlevpyvniaptsswtqhaswtlviavvapltystgastslditasiqp
vrpvfnglrhevlsrq

Timeline for d1mec2_:

• d1mec2_ first appeared (with stable ids) in SCOP 1.55
  
• d1mec2_ appears in SCOP 1.61
  
• d1mec2_ does not appear in SCOP 1.65