SCOPe 2.07: Domain d4lrta2: 4lrt A:295-343

Lineage for d4lrta2 (4lrt A:295-343)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.5: RuvA C-terminal domain-like [46928] (9 superfamilies)
   3 helices; bundle, right-handed twist

4. Superfamily a.5.7: post-HMGL domain-like [89000] (3 families)

5. Family a.5.7.0: automated matches [227294] (1 protein)
   not a true family

6. Protein automated matches [227119] (2 species)
   not a true protein

7. Species Thermomonospora curvata [TaxId:471852] [227772] (2 PDB entries)

8. Domain d4lrta2: 4lrt A:295-343 [235502]
   Other proteins in same PDB: d4lrta1, d4lrtc1
   automated match to d4lrsa2
   complexed with coa, gol, mg, na, pyr, so4

Details for d4lrta2

PDB Entry: 4lrt, 1.5 Å

PDB Description: Crystal and solution structures of the bifunctional enzyme (Aldolase/Aldehyde dehydrogenase) from Thermomonospora curvata, reveal a cofactor-binding domain motion during NAD+ and CoA accommodation whithin the shared cofactor-binding site

PDB Compounds: (A:) 4-hydroxy-2-oxovalerate aldolase

SCOPe Domain Sequences for d4lrta2:

Sequence; same for both SEQRES and ATOM records:

>d4lrta2 a.5.7.0 (A:295-343) automated matches {Thermomonospora curvata [TaxId: 471852]}
yssfllhaeraaerygvpaheilqrvgeagyvggqedmiidiavqlaee

Timeline for d4lrta2:

• d4lrta2 first appeared in SCOPe 2.03
  
• d4lrta2 appears in SCOPe 2.06
  
• d4lrta2 appears in the current release, SCOPe 2.08