Class b: All beta proteins [48724] (178 folds) |
Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies) sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies |
Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (10 families) |
Family b.121.4.1: Picornaviridae-like VP (VP1, VP2, VP3 and VP4) [88634] (10 proteins) the order of the chains N-VP0-VP3-VP1-C is as in the polyprotein; VP0 is cleaved later upon capsid assembly to VP4 and VP2 there is a different order in the shuffled genome of insect picorna-like proteins (Cricket paralysis virus) |
Protein Rhinovirus coat proteins [49670] (5 species) |
Species Human rhinovirus A 1A (HRV-1A) [TaxId:12134] [49673] (4 PDB entries) |
Domain d2hwe1_: 2hwe 1: [23543] complexed with w54 |
PDB Entry: 2hwe (more details), 3.8 Å
SCOPe Domain Sequences for d2hwe1_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hwe1_ b.121.4.1 (1:) Rhinovirus coat proteins {Human rhinovirus A 1A (HRV-1A) [TaxId: 12134]} nyidevlnevlvvpnikeshhttsnsaplldaaetghtsnvqpedaietryvitsqtrde msiesflgrsgcvhisrikvdytdyngqdinftkwkitlqemaqirrkfelftyvrfdse itlvpciagrgddighivmqymyvppgapipskrndfswqsgtnmsifwqhgqpfprfsi pflsiasayymfydgydgdntsskygsvvtndmgticsrivtekqklsvvitthiyhkak htkawcprppravpythshvtnympetgdvttaivrrntitta
Timeline for d2hwe1_: