SCOPe 2.07: Domain d4lfla_: 4lfl A:

Lineage for d4lfla_ (4lfl A:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.121: Ribose/Galactose isomerase RpiB/AlsB [89622] (1 superfamily)
   3 layers: a/b/a, core: parallel beta-sheet of 5 strands, order 21354; topological similarity to a part of the arginase/deacetylase fold

4. Superfamily c.121.1: Ribose/Galactose isomerase RpiB/AlsB [89623] (2 families)

5. Family c.121.1.0: automated matches [191649] (1 protein)
   not a true family

6. Protein automated matches [191196] (11 species)
   not a true protein

7. Species Lactobacillus rhamnosus [TaxId:568704] [229308] (4 PDB entries)

8. Domain d4lfla_: 4lfl A: [235355]
   automated match to d4lfma_
   complexed with tg6

Details for d4lfla_

PDB Entry: 4lfl, 1.65 Å

PDB Description: Crystal Structure of D-galactose-6-phosphate isomerase in complex with D-tagatose-6-phosphate

PDB Compounds: (A:) Galactose-6-phosphate isomerase subunit A

SCOPe Domain Sequences for d4lfla_:

Sequence; same for both SEQRES and ATOM records:

>d4lfla_ c.121.1.0 (A:) automated matches {Lactobacillus rhamnosus [TaxId: 568704]}
mdviigadkdgfamkeqvkkyleehqyrvadvtpepaedfvesslavtkkllnsdahkai
mfdrygvgsamasnkvkgmvtavveeentahmtaehngakaiaigtgitgydralviiqr
yldteyaggrhqirldmlekmi

Timeline for d4lfla_:

• d4lfla_ first appeared in SCOPe 2.03
  
• d4lfla_ appears in SCOPe 2.06
  
• d4lfla_ appears in the current release, SCOPe 2.08