![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.286: TrkA C-terminal domain-like [116725] (1 superfamily) beta-X-beta(2)-X-beta-alpha; pseudo barrel capped by helix at one end; topological similarity to the HPr-like fold |
![]() | Superfamily d.286.1: TrkA C-terminal domain-like [116726] (2 families) ![]() |
![]() | Family d.286.1.0: automated matches [228502] (1 protein) not a true family |
![]() | Protein automated matches [228504] (1 species) not a true protein |
![]() | Species Methanothermobacter thermautotrophicus [TaxId:187420] [228505] (8 PDB entries) |
![]() | Domain d4l75e2: 4l75 E:245-336 [235306] Other proteins in same PDB: d4l75a1, d4l75a3, d4l75b1, d4l75b3, d4l75c1, d4l75d1, d4l75d3, d4l75e1, d4l75f1, d4l75f3 automated match to d4l75d2 complexed with ca; mutant |
PDB Entry: 4l75 (more details), 2.39 Å
SCOPe Domain Sequences for d4l75e2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4l75e2 d.286.1.0 (E:245-336) automated matches {Methanothermobacter thermautotrophicus [TaxId: 187420]} dgyeamfvqdvlaeestrrmvevpipegsklegvsvldadihdvtgviiigvgrgdelii dpprdysfragdiilgigkpeeierlknyisa
Timeline for d4l75e2: