Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.9: Potassium channel NAD-binding domain [63944] (5 proteins) automatically mapped to Pfam PF02254 |
Protein automated matches [228498] (1 species) not a true protein |
Species Methanothermobacter thermautotrophicus [TaxId:187420] [228499] (8 PDB entries) |
Domain d4l76b1: 4l76 B:115-244 [235299] Other proteins in same PDB: d4l76a2, d4l76a3, d4l76b2, d4l76b3, d4l76c2, d4l76d2, d4l76d3, d4l76e2, d4l76e3, d4l76f2, d4l76f3 automated match to d4l76e1 complexed with ca, na; mutant |
PDB Entry: 4l76 (more details), 2.99 Å
SCOPe Domain Sequences for d4l76b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4l76b1 c.2.1.9 (B:115-244) automated matches {Methanothermobacter thermautotrophicus [TaxId: 187420]} srhvvicgwsestleclrelrgsevfvlaedenvrkkvlrsganfvhgdptrvsdlekan vrgaravivdlesdsetihcilgirkidesvriiaeaqryenieqlrmagadqvispfvi sgrlmsrsid
Timeline for d4l76b1: