Lineage for d4ks4a_ (4ks4 A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2417088Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies)
    consists of six 4-stranded beta-sheet motifs; meander
  4. 2417089Superfamily b.68.1: Sialidases [50939] (3 families) (S)
  5. 2417611Family b.68.1.0: automated matches [191452] (1 protein)
    not a true family
  6. 2417612Protein automated matches [190692] (20 species)
    not a true protein
  7. 2417630Species Influenza A virus (a/duck/ukraine/1/1963(h3n8)) [TaxId:385580] [189572] (10 PDB entries)
  8. 2417637Domain d4ks4a_: 4ks4 A: [235222]
    automated match to d4ks1a_
    complexed with 1sn, ca

Details for d4ks4a_

PDB Entry: 4ks4 (more details), 2.5 Å

PDB Description: influenza neuraminidase in complex with antiviral compound (3s,4r,5r)- 4-(acetylamino)-3-{4-[(1r)-1-hydroxypropyl]-1h-1,2,3-triazol-1-yl}-5- (pentan-3-yloxy)cyclohex-1-ene-1-carboxylic acid
PDB Compounds: (A:) Neuraminidase

SCOPe Domain Sequences for d4ks4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ks4a_ b.68.1.0 (A:) automated matches {Influenza A virus (a/duck/ukraine/1/1963(h3n8)) [TaxId: 385580]}
tymnnteaicdvkgfapfskdngirigsrghifvirepfvscspiecrtffltqgsllnd
khsngtvkdrspfrtlmsvkvgqspnvyqarfeavawsatachdgkkwmtvgvtgpdska
vavihyggvptdvinswagdilrtqessctciqgdcywvmtdgpanrqaqyriykanqgr
iigqadisfngghieecscypndgkvecvcrdnwtgtnrpvlvispdlsyrvgylcagip
sdtprgedaqftgsctspmgnqgygvkgfgfrqgtdvwmgrtisrtsrsgfeilrikngw
tqtskeqvrkqvvvdnlnwsgysgsftlpvelsgkdclvpcfwvemirgkpeektiwtss
ssivmcgvdyeiadwswhdgailpfdidk

SCOPe Domain Coordinates for d4ks4a_:

Click to download the PDB-style file with coordinates for d4ks4a_.
(The format of our PDB-style files is described here.)

Timeline for d4ks4a_: