SCOPe 2.04: Domain d4kqob2: 4kqo B:222-563

Lineage for d4kqob2 (4kqo B:222-563)

1. Root: SCOPe 2.04

2. Class e: Multi-domain proteins (alpha and beta) [56572] (68 folds)

3. Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
   contains a cluster of helices and an alpha+beta sandwich

4. Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families)

5. Family e.3.1.0: automated matches [191512] (1 protein)
   not a true family

6. Protein automated matches [190857] (19 species)
   not a true protein

7. Species Pseudomonas aeruginosa [TaxId:208964] [196777] (13 PDB entries)

8. Domain d4kqob2: 4kqo B:222-563 [235208]
   Other proteins in same PDB: d4kqoa1, d4kqob1
   automated match to d4kqoa2
   complexed with cl, gol, imd, jpp

Details for d4kqob2

PDB Entry: 4kqo, 2.31 Å

PDB Description: Crystal structure of penicillin-binding protein 3 from pseudomonas aeruginosa in complex with piperacillin

PDB Compounds: (B:) penicillin-binding protein 3

SCOPe Domain Sequences for d4kqob2:

Sequence; same for both SEQRES and ATOM records:

>d4kqob2 e.3.1.0 (B:222-563) automated matches {Pseudomonas aeruginosa [TaxId: 208964]}
sidlrlqylahrelrnallengakagslvimdvktgeilamtnqptynpnnrrnlqpaam
rnramidvfepgstvkpfsmsaalasgrwkpsdivdvypgtlqigrytirdvsrnsrqld
ltgilikssnvgiskiafdigaesiysvmqqvglgqdtglgfpgervgnlpnhrkwpkae
tatlaygyglsvtaiqlahayaalandgksvplsmtrvdrvpdgvqvispevastvqgml
qqvveaqggvfraqvpgyhaagksgtarkvsvgtkgyrenayrslfagfapatdpriamv
vvidepskagyfgglvsapvfskvmagalrlmnvppdnlpta

Timeline for d4kqob2:

• d4kqob2 first appeared in SCOPe 2.03
  
• d4kqob2 appears in SCOPe 2.05
  
• d4kqob2 appears in the current release, SCOPe 2.08