Lineage for d4k71b2 (4k71 B:177-268)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2749859Protein automated matches [190374] (15 species)
    not a true protein
  7. 2749887Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)
  8. 2751034Domain d4k71b2: 4k71 B:177-268 [235112]
    Other proteins in same PDB: d4k71a1, d4k71a2, d4k71a3, d4k71b1, d4k71c_, d4k71d1, d4k71d2, d4k71d3, d4k71e1, d4k71f_
    automated match to d4k71e2
    complexed with so4

Details for d4k71b2

PDB Entry: 4k71 (more details), 2.4 Å

PDB Description: Crystal structure of a high affinity Human Serum Albumin variant bound to the Neonatal Fc Receptor
PDB Compounds: (B:) igg receptor fcrn large subunit p51

SCOPe Domain Sequences for d4k71b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4k71b2 b.1.1.2 (B:177-268) automated matches {Human (Homo sapiens) [TaxId: 9606]}
keppsmrlkarpsspgfsvltcsafsfyppelqlrflrnglaagtgqgdfgpnsdgsfha
sssltvksgdehhyccivqhaglaqplrvele

SCOPe Domain Coordinates for d4k71b2:

Click to download the PDB-style file with coordinates for d4k71b2.
(The format of our PDB-style files is described here.)

Timeline for d4k71b2: