Lineage for d4jvza_ (4jvz A:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1540029Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 1542731Superfamily b.40.15: EutN/CcmL-like [159133] (1 family) (S)
    homohexameric unit
  5. 1542732Family b.40.15.1: EutN/CcmL-like [159134] (4 proteins)
    Pfam PF03319
  6. 1542733Protein Carbon dioxide concentrating mechanism protein CcmL [159139] (3 species)
  7. 1542776Species Thermosynechococcus elongatus [TaxId:197221] [227737] (2 PDB entries)
  8. 1542782Domain d4jvza_: 4jvz A: [235055]
    automated match to d4jvzd_
    complexed with so4

Details for d4jvza_

PDB Entry: 4jvz (more details), 2.01 Å

PDB Description: Structure of Thermosynechococcus elongatus CcmL
PDB Compounds: (A:) Carbon dioxide concentrating mechanism protein

SCOPe Domain Sequences for d4jvza_:

Sequence, based on SEQRES records: (download)

>d4jvza_ b.40.15.1 (A:) Carbon dioxide concentrating mechanism protein CcmL {Thermosynechococcus elongatus [TaxId: 197221]}
mkiarvcgtvtstqkedtltgvkflvlqylgedgeflpdyevaadtvgagqdewvlvsrg
saarhiingtdkpidaavvaiidtvsrdnyllys

Sequence, based on observed residues (ATOM records): (download)

>d4jvza_ b.40.15.1 (A:) Carbon dioxide concentrating mechanism protein CcmL {Thermosynechococcus elongatus [TaxId: 197221]}
mkiarvcgtvtstqkedtltgvkflvlqylggeflpdyevaadtvgagqdewvlvsrgsa
arhiingtdkpidaavvaiidtvsrdnyllys

SCOPe Domain Coordinates for d4jvza_:

Click to download the PDB-style file with coordinates for d4jvza_.
(The format of our PDB-style files is described here.)

Timeline for d4jvza_: