SCOPe 2.07: Domain d4i7wa_: 4i7w A:

Lineage for d4i7wa_ (4i7w A:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.10: Aldolase [51569] (9 families)
   Common fold covers whole protein structure

5. Family c.1.10.0: automated matches [191319] (1 protein)
   not a true family

6. Protein automated matches [190115] (91 species)
   not a true protein

7. Species Agrobacterium sp. [TaxId:861208] [229400] (3 PDB entries)

8. Domain d4i7wa_: 4i7w A: [234835]
   automated match to d4i7vd_
   complexed with gol, lys

Details for d4i7wa_

PDB Entry: 4i7w, 1.3 Å

PDB Description: Agrobacterium tumefaciens DHDPS with lysine and pyruvate

PDB Compounds: (A:) Dihydrodipicolinate synthase

SCOPe Domain Sequences for d4i7wa_:

Sequence; same for both SEQRES and ATOM records:

>d4i7wa_ c.1.10.0 (A:) automated matches {Agrobacterium sp. [TaxId: 861208]}
mfkgsipalitpftdngavdeqafaahvewqiaegsnglvpvgttgesptlshdehkrvv
elcievaakrvpviagagsnntdeaielalhaqdagadallvvtpyynkptqkglfahfs
avaeavklpiviynipprsvvdmspetmgalvkahknivgvxdatgkldrvseqriscgk
dfiqlsgedstalgfnahggvgcisvsanvaprlcsefqaamlagdyakaleyqdrlmpl
hraifmepgvcgtkyalsktrgcnrkvrsplmstlepateaaidaalkhaglmn

Timeline for d4i7wa_:

• d4i7wa_ first appeared in SCOPe 2.03
  
• d4i7wa_ appears in SCOPe 2.06
  
• d4i7wa_ appears in the current release, SCOPe 2.08