![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.10: Aldolase [51569] (9 families) ![]() Common fold covers whole protein structure |
![]() | Family c.1.10.0: automated matches [191319] (1 protein) not a true family |
![]() | Protein automated matches [190115] (91 species) not a true protein |
![]() | Species Agrobacterium sp. [TaxId:861208] [229400] (3 PDB entries) |
![]() | Domain d4i7vb_: 4i7v B: [234834] automated match to d4i7vd_ |
PDB Entry: 4i7v (more details), 1.45 Å
SCOPe Domain Sequences for d4i7vb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4i7vb_ c.1.10.0 (B:) automated matches {Agrobacterium sp. [TaxId: 861208]} mfkgsipalitpftdngavdeqafaahvewqiaegsnglvpvgttgesptlshdehkrvv elcievaakrvpviagagsnntdeaielalhaqdagadallvvtpyynkptqkglfahfs avaeavklpiviynipprsvvdmspetmgalvkahknivgvxdatgkldrvseqriscgk dfiqlsgedstalgfnahggvgcisvsanvaprlcsefqaamlagdyakaleyqdrlmpl hraifmepgvcgtkyalsktrgcnrkvrsplmstlepateaaidaalkhaglm
Timeline for d4i7vb_: