Lineage for d4i7vb_ (4i7v B:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2434695Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2443024Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 2444581Family c.1.10.0: automated matches [191319] (1 protein)
    not a true family
  6. 2444582Protein automated matches [190115] (91 species)
    not a true protein
  7. 2444620Species Agrobacterium sp. [TaxId:861208] [229400] (3 PDB entries)
  8. 2444624Domain d4i7vb_: 4i7v B: [234834]
    automated match to d4i7vd_

Details for d4i7vb_

PDB Entry: 4i7v (more details), 1.45 Å

PDB Description: Agrobacterium tumefaciens DHDPS with pyruvate
PDB Compounds: (B:) Dihydrodipicolinate synthase

SCOPe Domain Sequences for d4i7vb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4i7vb_ c.1.10.0 (B:) automated matches {Agrobacterium sp. [TaxId: 861208]}
mfkgsipalitpftdngavdeqafaahvewqiaegsnglvpvgttgesptlshdehkrvv
elcievaakrvpviagagsnntdeaielalhaqdagadallvvtpyynkptqkglfahfs
avaeavklpiviynipprsvvdmspetmgalvkahknivgvxdatgkldrvseqriscgk
dfiqlsgedstalgfnahggvgcisvsanvaprlcsefqaamlagdyakaleyqdrlmpl
hraifmepgvcgtkyalsktrgcnrkvrsplmstlepateaaidaalkhaglm

SCOPe Domain Coordinates for d4i7vb_:

Click to download the PDB-style file with coordinates for d4i7vb_.
(The format of our PDB-style files is described here.)

Timeline for d4i7vb_: