Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.1: Triosephosphate isomerase (TIM) [51351] (2 families) |
Family c.1.1.0: automated matches [191424] (1 protein) not a true family |
Protein automated matches [190605] (13 species) not a true protein |
Species Trypanosoma cruzi [TaxId:5693] [228042] (2 PDB entries) |
Domain d4hhpa_: 4hhp A: [234648] automated match to d4hhpb_ complexed with gol, so4; mutant |
PDB Entry: 4hhp (more details), 1.5 Å
SCOPe Domain Sequences for d4hhpa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4hhpa_ c.1.1.0 (A:) automated matches {Trypanosoma cruzi [TaxId: 5693]} skpqpiaaanwkcngsesllvplietlnaatfdhdvqcvvaptflhipmtkarltnpkfq iaaqnaitrsgaftgevslqilkdygiswvvlghserrlyygdtneivaekvaqacaagf hvivcvgetneereagrtaavvltqlaavaqklskeawsrvviayepvwaigtgkvatpq qaqevhellrrwvrsklgtdiaaqlrilyggsvtaknartlyqmrdingflvggaslkpe fveiieatk
Timeline for d4hhpa_: