Lineage for d4hhpa_ (4hhp A:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1336838Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1336839Superfamily c.1.1: Triosephosphate isomerase (TIM) [51351] (2 families) (S)
  5. 1337170Family c.1.1.0: automated matches [191424] (1 protein)
    not a true family
  6. 1337171Protein automated matches [190605] (13 species)
    not a true protein
  7. 1337235Species Trypanosoma cruzi [TaxId:5693] [228042] (2 PDB entries)
  8. 1337236Domain d4hhpa_: 4hhp A: [234648]
    automated match to d4hhpb_
    complexed with gol, so4; mutant

Details for d4hhpa_

PDB Entry: 4hhp (more details), 1.5 Å

PDB Description: Crystal structure of triosephosphate isomerase from trypanosoma cruzi, mutant e105d
PDB Compounds: (A:) Triosephosphate isomerase, glycosomal

SCOPe Domain Sequences for d4hhpa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4hhpa_ c.1.1.0 (A:) automated matches {Trypanosoma cruzi [TaxId: 5693]}
skpqpiaaanwkcngsesllvplietlnaatfdhdvqcvvaptflhipmtkarltnpkfq
iaaqnaitrsgaftgevslqilkdygiswvvlghserrlyygdtneivaekvaqacaagf
hvivcvgetneereagrtaavvltqlaavaqklskeawsrvviayepvwaigtgkvatpq
qaqevhellrrwvrsklgtdiaaqlrilyggsvtaknartlyqmrdingflvggaslkpe
fveiieatk

SCOPe Domain Coordinates for d4hhpa_:

Click to download the PDB-style file with coordinates for d4hhpa_.
(The format of our PDB-style files is described here.)

Timeline for d4hhpa_: