SCOPe 2.08: Domain d4h88a_: 4h88 A:

Lineage for d4h88a_ (4h88 A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.6: Prion-like [54097] (1 superfamily)
   beta-alpha-beta-alpha(2); antiparallel beta-ribbon

4. Superfamily d.6.1: Prion-like [54098] (1 family)

5. Family d.6.1.1: Prion-like [54099] (3 proteins)

6. Protein automated matches [191016] (9 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [234629] (15 PDB entries)

8. Domain d4h88a_: 4h88 A: [234630]
   Other proteins in same PDB: d4h88h1, d4h88h2, d4h88l1, d4h88l2
   automated match to d1xyxa_
   complexed with na

Details for d4h88a_

PDB Entry: 4h88, 1.9 Å

PDB Description: Structure of POM1 FAB fragment complexed with mouse PrPc Fragment 120-230

PDB Compounds: (A:) major prion protein

SCOPe Domain Sequences for d4h88a_:

Sequence; same for both SEQRES and ATOM records:

>d4h88a_ d.6.1.1 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
lggymlgsamsrpmihfgndwedryyrenmyrypnqvyyrpvdqysnqnnfvhdcvniti
kqhtvvtttkgenftetdvkmmervveqmcvtqyqkesqayy

Timeline for d4h88a_:

• d4h88a_ first appeared in SCOPe 2.03
  
• d4h88a_ appears in SCOPe 2.07