SCOP 1.63: Domain d2rr12_: 2rr1 2:

Lineage for d2rr12_ (2rr1 2:)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.10: Viral coat and capsid proteins [49610] (1 superfamily)
   sandwich; 8 strands in 2 sheets; jelly-roll
   variations: some members have additional 1-2 strands

4. Superfamily b.10.1: Viral coat and capsid proteins [49611] (4 families)

5. Family b.10.1.4: Animal virus proteins [49656] (18 proteins)
   mammalian viruses

6. Protein Rhinovirus coat protein [49670] (5 species)

7. Species Human rhinovirus 14 [TaxId:12131] [49671] (28 PDB entries)

8. Domain d2rr12_: 2rr1 2: [23454]

Details for d2rr12_

PDB Entry: 2rr1, 3 Å

PDB Description: structural analysis of antiviral agents that interact with the capsid of human rhinoviruses

SCOP Domain Sequences for d2rr12_:

Sequence; same for both SEQRES and ATOM records:

>d2rr12_ b.10.1.4 (2:) Rhinovirus coat protein {Human rhinovirus 14}
gysdrvqqitlgnstittqeaanavvcyaewpeylpdvdasdvnktskpdtsvcrfytld
sktwttgskgwcwklpdalkdmgvfgqnmffhslgrsgytvhvqcnatkfhsgcllvvvi
pehqlasheggnvsvkytfthpgergidlssanevggpvkdvlynmngtllgnllifphq
finlrtnntativipyinsvpidsmtrhnnvslmvipiapltvptgatpslpitvtiapm
ctefsgirsksivpq

Timeline for d2rr12_:

• d2rr12_ first appeared (with stable ids) in SCOP 1.55
  
• d2rr12_ appears in SCOP 1.61
  
• d2rr12_ does not appear in SCOP 1.65