SCOPe 2.03: Domain d4eukb_: 4euk B:

Lineage for d4eukb_ (4euk B:)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies)
   core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down

4. Superfamily a.24.10: Histidine-containing phosphotransfer domain, HPT domain [47226] (7 families)
   contains additional, fifth helix at the N-terminus

5. Family a.24.10.0: automated matches [227273] (1 protein)
   not a true family

6. Protein automated matches [227077] (2 species)
   not a true protein

7. Species Arabidopsis thaliana [TaxId:3702] [234400] (1 PDB entry)

8. Domain d4eukb_: 4euk B: [234401]
   automated match to d3us6a_
   complexed with edo, mg

Details for d4eukb_

PDB Entry: 4euk, 1.95 Å

PDB Description: crystal structure

PDB Compounds: (B:) Histidine-containing phosphotransfer protein 1

SCOPe Domain Sequences for d4eukb_:

Sequence; same for both SEQRES and ATOM records:

>d4eukb_ a.24.10.0 (B:) automated matches {Arabidopsis thaliana [TaxId: 3702]}
mdlvqkqkslqdytkslflegildsqflqlqqlqdesnpdfvsqvvtlffqdsdrilndl
slsldqqvvdfkkvdphvhqlkgssssigaqrvknacvvfrsfceqqnveachrclqqvk
qeyylvknrletlfkleqqivasggmipavel

Timeline for d4eukb_:

• d4eukb_ is new in SCOPe 2.03-stable
  
• d4eukb_ appears in SCOPe 2.04
  
• d4eukb_ appears in the current release, SCOPe 2.08