SCOPe 2.08: Domain d4e8gb1: 4e8g B:2-126

Lineage for d4e8gb1 (4e8g B:2-126)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
   beta(3)-alpha(3); meander and up-and-down bundle

4. Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families)

5. Family d.54.1.0: automated matches [227195] (1 protein)
   not a true family

6. Protein automated matches [226922] (95 species)
   not a true protein

7. Species Paracoccus denitrificans [TaxId:318586] [234364] (3 PDB entries)

8. Domain d4e8gb1: 4e8g B:2-126 [234366]
   Other proteins in same PDB: d4e8ga2, d4e8ga3, d4e8gb2, d4e8gb3
   automated match to d4mggf1
   complexed with mg, unl

Details for d4e8gb1

PDB Entry: 4e8g, 2 Å

PDB Description: crystal structure of an enolase (mandelate racemase subgroup) from paracococus denitrificans pd1222 (target nysgrc-012907) with bound mg

PDB Compounds: (B:) Mandelate racemase/muconate lactonizing enzyme, N-terminal domain protein

SCOPe Domain Sequences for d4e8gb1:

Sequence, based on SEQRES records:

>d4e8gb1 d.54.1.0 (B:2-126) automated matches {Paracoccus denitrificans [TaxId: 318586]}
kiaeihvyahdlpvkdgpytiasstvwslqttlvkivadsglagwgetcpvgptyapsha
lgaraalaemapgliganplqplvlrrrmdgllcghnyakaaidiaaydlmgkhygvrva
dllgg

Sequence, based on observed residues (ATOM records):

>d4e8gb1 d.54.1.0 (B:2-126) automated matches {Paracoccus denitrificans [TaxId: 318586]}
kiaeihvyahdlpvkdgpytistvwslqttlvkivadsglagwgetcpvgptyapshalg
araalaemapgliganplqplvlrrrmdgllcghnyakaaidiaaydlmgkhygvrvadl
lgg

Timeline for d4e8gb1:

• d4e8gb1 first appeared in SCOPe 2.03
  
• d4e8gb1 appears in SCOPe 2.07