![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
![]() | Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (86 families) ![]() contains a small beta-sheet (wing) |
![]() | Family a.4.5.0: automated matches [191329] (1 protein) not a true family |
![]() | Protein automated matches [190154] (87 species) not a true protein |
![]() | Species Linum nodiflorum [TaxId:407264] [234362] (3 PDB entries) |
![]() | Domain d4e70a1: 4e70 A:1-112 [234363] Other proteins in same PDB: d4e70a2, d4e70b2, d4e70b3 automated match to d1zgaa1 complexed with gol, n7i |
PDB Entry: 4e70 (more details), 1.61 Å
SCOPe Domain Sequences for d4e70a1:
Sequence, based on SEQRES records: (download)
>d4e70a1 a.4.5.0 (A:1-112) automated matches {Linum nodiflorum [TaxId: 407264]} mdaatavelldaqpqvwhhflgyinsmtlqcaleldiadvihrhghpiplnqlaaaleip qtkapflsrlmrmlvhlgyftqvitkpedenddvlpsywlaplsrlllkqnp
>d4e70a1 a.4.5.0 (A:1-112) automated matches {Linum nodiflorum [TaxId: 407264]} mdaatavelldaqpqvwhhflgyinsmtlqcaleldiadvihrhghpiplnqlaaaleip qtkapflsrlmrmlvhlgyftqvitkpvlpsywlaplsrlllkqnp
Timeline for d4e70a1: