Lineage for d1vbc1_ (1vbc 1:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2430785Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
    sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
    characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies
  4. 2431062Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (10 families) (S)
  5. 2431063Family b.121.4.1: Picornaviridae-like VP (VP1, VP2, VP3 and VP4) [88634] (10 proteins)
    the order of the chains N-VP0-VP3-VP1-C is as in the polyprotein; VP0 is cleaved later upon capsid assembly to VP4 and VP2
    there is a different order in the shuffled genome of insect picorna-like proteins (Cricket paralysis virus)
  6. 2431121Protein Poliovirus coat proteins [49666] (3 species)
  7. 2431162Species Poliovirus type 3, strain Sabin [TaxId:12086] [49669] (7 PDB entries)
  8. 2431170Domain d1vbc1_: 1vbc 1: [23423]
    complexed with j77, myr

Details for d1vbc1_

PDB Entry: 1vbc (more details), 2.8 Å

PDB Description: poliovirus (type 3, sabin strain) (p3/sabin, p3/leon/12a(1)b) complexed with r77975
PDB Compounds: (1:) poliovirus type 3

SCOPe Domain Sequences for d1vbc1_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vbc1_ b.121.4.1 (1:) Poliovirus coat proteins {Poliovirus type 3, strain Sabin [TaxId: 12086]}
qdslpdtkasgpahskevpaltavetgatnplapsdtvqtrhvvqrrsrsestiesffar
gacvaiievdneqpttraqklfamwritykdtvqlrrklefftysrfdmeftfvvtanft
nannghalnqvyqimyippgaptpkswddytwqtssnpsifytygaaparisvpyvglan
ayshfydgfakvplktdandqigdslysamtvddfgvlavrvvndhnptkvtskvriymk
pkhvrvwcprppravpyygpgvdyrnnldplsekgltty

SCOPe Domain Coordinates for d1vbc1_:

Click to download the PDB-style file with coordinates for d1vbc1_.
(The format of our PDB-style files is described here.)

Timeline for d1vbc1_: