Lineage for d4bn0d_ (4bn0 D:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1608160Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 1608177Superfamily c.56.2: Purine and uridine phosphorylases [53167] (2 families) (S)
    complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8
  5. 1608995Family c.56.2.0: automated matches [191488] (1 protein)
    not a true family
  6. 1608996Protein automated matches [190781] (30 species)
    not a true protein
  7. 1609074Species Helicobacter pylori [TaxId:85962] [227827] (5 PDB entries)
  8. 1609085Domain d4bn0d_: 4bn0 D: [234205]
    automated match to d4bn0a_
    mutant

Details for d4bn0d_

PDB Entry: 4bn0 (more details), 2.11 Å

PDB Description: Structure of futalosine hydrolase mutant of Helicobacter pylori strain 26695
PDB Compounds: (D:) MTA/SAH nucleosidase

SCOPe Domain Sequences for d4bn0d_:

Sequence, based on SEQRES records: (download)

>d4bn0d_ c.56.2.0 (D:) automated matches {Helicobacter pylori [TaxId: 85962]}
vqkigilgamreqitpilelfgvdfeeiplggnvfhkgvyhnkeiivayskigkvhstlt
ttsmilafgvqkvlfsgvagslvkdlkindllvaiqlvqhdvdlsafdhplgfipesaif
ietseslnalakevaneqhivlkegviasgdqfvhskerkeflvsefkasavemegasva
fvcqkfgvpccvlrsisdnadeeanmsfdafleksaqtsakflksmvdel

Sequence, based on observed residues (ATOM records): (download)

>d4bn0d_ c.56.2.0 (D:) automated matches {Helicobacter pylori [TaxId: 85962]}
vqkigilgamreqitpilelfgvdfeeiplggnvfhkgvyhnkeiivayskigkvhstlt
ttsmilafgvqkvlfsgvagslvkdlkindllvaiqlvqhdvdlsafdhplgfipesaif
ietseslnalakevaneqhivlkegviasgdqfvhskerkeflvsefkasavemegasva
fvcqkfgvpccvlrsisdnsfdafleksaqtsakflksmvdel

SCOPe Domain Coordinates for d4bn0d_:

Click to download the PDB-style file with coordinates for d4bn0d_.
(The format of our PDB-style files is described here.)

Timeline for d4bn0d_: