SCOPe 2.07: Domain d4bbec_: 4bbe C:

Lineage for d4bbec_ (4bbe C:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.0: automated matches [191359] (1 protein)
   not a true family

6. Protein automated matches [190417] (35 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187294] (1319 PDB entries)

8. Domain d4bbec_: 4bbe C: [234140]
   automated match to d4bbfc_
   complexed with 3o4

Details for d4bbec_

PDB Entry: 4bbe, 1.9 Å

PDB Description: Aminoalkylpyrimidine Inhibitor Complexes with JAK2

PDB Compounds: (C:) Tyrosine-protein kinase JAK2

SCOPe Domain Sequences for d4bbec_:

Sequence; same for both SEQRES and ATOM records:

>d4bbec_ d.144.1.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ptqfeerhlkflqqlgkgnfgsvemcrydplqdntgevvavkklqhsteehlrdfereie
ilkslqhdnivkykgvcysagrrnlklimeylpygslrdylqkhkeridhikllqytsqi
ckgmeylgtkryihrnlatrnilvenenrvkigdfgltkvlpqdkeyykvkepgespifw
yapeslteskfsvasdvwsfgvvlyelftyieksksppaefmrmigndkqgqmivfhlie
llknngrlprpdgcpdeiymimtecwnnnvnqrpsfrdlalrvdqird

Timeline for d4bbec_:

• d4bbec_ first appeared in SCOPe 2.03
  
• d4bbec_ appears in SCOPe 2.06
  
• d4bbec_ appears in the current release, SCOPe 2.08