Lineage for d3vz8c_ (3vz8 C:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2850950Fold c.8: The 'swivelling' beta/beta/alpha domain [52008] (10 superfamilies)
    3 layers: b/b/a; the central sheet is parallel, and the other one is antiparallel; there are some variations in topology
    this domain is thought to be mobile in most multi-domain proteins known to contain it
  4. 2851157Superfamily c.8.5: GroEL apical domain-like [52029] (3 families) (S)
  5. 2851158Family c.8.5.1: GroEL-like chaperone, apical domain [52030] (2 proteins)
  6. 2851353Protein automated matches [191245] (3 species)
    not a true protein
  7. 2851356Species Escherichia coli [TaxId:562] [229023] (2 PDB entries)
  8. 2851360Domain d3vz8c_: 3vz8 C: [233881]
    automated match to d3vz8a_

Details for d3vz8c_

PDB Entry: 3vz8 (more details), 1.9 Å

PDB Description: Crystal Structure Analysis of the Mini-chaperonin variant with Leu 185, Val 186, Pro 187, Arg 188 and Ser 190 replaced with all Gly
PDB Compounds: (C:) 60 kda chaperonin

SCOPe Domain Sequences for d3vz8c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3vz8c_ c.8.5.1 (C:) automated matches {Escherichia coli [TaxId: 562]}
gmqfdrgylspyfinkpetgavelespfilladkkisniremlpvleavakagkplliia
edvegealatlvvntmrgivkvaavkapgfgdrrkamlqdiatltggtviseeigmelek
atledlgqakrvvinkdtttiidgvgeeaaiqgrvaqirqqieeatsdydreklqervak
laggv

SCOPe Domain Coordinates for d3vz8c_:

Click to download the PDB-style file with coordinates for d3vz8c_.
(The format of our PDB-style files is described here.)

Timeline for d3vz8c_: