Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.8: The 'swivelling' beta/beta/alpha domain [52008] (10 superfamilies) 3 layers: b/b/a; the central sheet is parallel, and the other one is antiparallel; there are some variations in topology this domain is thought to be mobile in most multi-domain proteins known to contain it |
Superfamily c.8.5: GroEL apical domain-like [52029] (3 families) |
Family c.8.5.1: GroEL-like chaperone, apical domain [52030] (2 proteins) |
Protein automated matches [191245] (3 species) not a true protein |
Species Escherichia coli [TaxId:562] [229023] (2 PDB entries) |
Domain d3vz8c_: 3vz8 C: [233881] automated match to d3vz8a_ |
PDB Entry: 3vz8 (more details), 1.9 Å
SCOPe Domain Sequences for d3vz8c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3vz8c_ c.8.5.1 (C:) automated matches {Escherichia coli [TaxId: 562]} gmqfdrgylspyfinkpetgavelespfilladkkisniremlpvleavakagkplliia edvegealatlvvntmrgivkvaavkapgfgdrrkamlqdiatltggtviseeigmelek atledlgqakrvvinkdtttiidgvgeeaaiqgrvaqirqqieeatsdydreklqervak laggv
Timeline for d3vz8c_: