SCOPe 2.08: Domain d3vz8b_: 3vz8 B:

Lineage for d3vz8b_ (3vz8 B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.8: The 'swivelling' beta/beta/alpha domain [52008] (10 superfamilies)
   3 layers: b/b/a; the central sheet is parallel, and the other one is antiparallel; there are some variations in topology
   this domain is thought to be mobile in most multi-domain proteins known to contain it

4. Superfamily c.8.5: GroEL apical domain-like [52029] (3 families)

5. Family c.8.5.1: GroEL-like chaperone, apical domain [52030] (2 proteins)

6. Protein automated matches [191245] (3 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [229023] (2 PDB entries)

8. Domain d3vz8b_: 3vz8 B: [233880]
   automated match to d3vz8a_

Details for d3vz8b_

PDB Entry: 3vz8, 1.9 Å

PDB Description: Crystal Structure Analysis of the Mini-chaperonin variant with Leu 185, Val 186, Pro 187, Arg 188 and Ser 190 replaced with all Gly

PDB Compounds: (B:) 60 kda chaperonin

SCOPe Domain Sequences for d3vz8b_:

Sequence; same for both SEQRES and ATOM records:

>d3vz8b_ c.8.5.1 (B:) automated matches {Escherichia coli [TaxId: 562]}
gmqfdrgylspyfinkpetgavelespfilladkkisniremlpvleavakagkplliia
edvegealatlvvntmrgivkvaavkapgfgdrrkamlqdiatltggtviseeigmelek
atledlgqakrvvinkdtttiidgvgeeaaiqgrvaqirqqieeatsdydreklqervak
laggv

Timeline for d3vz8b_:

• d3vz8b_ first appeared in SCOPe 2.03
  
• d3vz8b_ appears in SCOPe 2.07