Lineage for d1fmd3_ (1fmd 3:)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 382736Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
    sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
    characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies
  4. 382819Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (8 families) (S)
  5. 382820Family b.121.4.1: Picornaviridae-like VP (VP1, VP2, VP3 and VP4) [88634] (9 proteins)
    the order of the chains N-VP0-VP3-VP1-C is as in the polyprotein; VP0 is cleaved later upon capsid assembly to VP4 and VP2
    there is a different order in the shuffled genome of insect picorna-like proteins (Cricket paralysis virus)
  6. 382821Protein Aphthovirus (Foot-and-mouth disease virus) coat proteins [49659] (1 species)
  7. 382822Species FMDV (Foot-and-mouth disease virus), strain bfs, 1860 [TaxId:12110] [49660] (4 PDB entries)
  8. 382834Domain d1fmd3_: 1fmd 3: [23374]

Details for d1fmd3_

PDB Entry: 1fmd (more details), 3.5 Å

PDB Description: the structure and antigenicity of a type c foot-and-mouth disease virus

SCOP Domain Sequences for d1fmd3_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fmd3_ b.121.4.1 (3:) Aphthovirus (Foot-and-mouth disease virus) coat proteins {FMDV (Foot-and-mouth disease virus), strain bfs, 1860}
gifpvacsdgygnmvttdpktadpaygkvynpprtalpgrftnyldvaeacptflmfenv
pyvstrtdgqrllakfdvslaakhmsntylaglaqyytqytgtinlhfmftgptdakary
mvayvppgmdapdnpeeaahcihaewdtglnskftfsipyisaadytytasheaettcvq
gwvcvyqithgkadadalvvsasagkdfelrlpvdarqq

SCOP Domain Coordinates for d1fmd3_:

Click to download the PDB-style file with coordinates for d1fmd3_.
(The format of our PDB-style files is described here.)

Timeline for d1fmd3_: