Lineage for d3toyb1 (3toy B:2-132)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2554471Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 2554472Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) (S)
  5. 2554768Family d.54.1.0: automated matches [227195] (1 protein)
    not a true family
  6. 2554769Protein automated matches [226922] (94 species)
    not a true protein
  7. 2554915Species Bradyrhizobium sp. [TaxId:114615] [233695] (2 PDB entries)
  8. 2554917Domain d3toyb1: 3toy B:2-132 [233698]
    Other proteins in same PDB: d3toya2, d3toyb2, d3toyc2, d3toyd2
    automated match to d4hncb1
    complexed with act, ca, ni, p4c

Details for d3toyb1

PDB Entry: 3toy (more details), 1.8 Å

PDB Description: crystal structure of enolase brado_4202 (target efi-501651) from bradyrhizobium sp. ors278 with calcium and acetate bound
PDB Compounds: (B:) mandelate racemase/muconate lactonizing enzyme family protein

SCOPe Domain Sequences for d3toyb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3toyb1 d.54.1.0 (B:2-132) automated matches {Bradyrhizobium sp. [TaxId: 114615]}
ttaaitgvtaravitpmkrplrnafgvidsgplvlidvttdqgvtghsylfaytrlalkp
lvhlvedigrelagkalvpvdlmkamdakfrllgwqglvgmavsgldmafwdalgqlagk
pvvellggsar

SCOPe Domain Coordinates for d3toyb1:

Click to download the PDB-style file with coordinates for d3toyb1.
(The format of our PDB-style files is described here.)

Timeline for d3toyb1: