Class g: Small proteins [56992] (100 folds) |
Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies) disulfide-bound fold; contains beta-hairpin with two adjacent disulfides |
Superfamily g.3.11: EGF/Laminin [57196] (8 families) |
Family g.3.11.0: automated matches [227227] (1 protein) not a true family |
Protein automated matches [226968] (5 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [225423] (30 PDB entries) |
Domain d3th3l1: 3th3 L:47-86 [233679] Other proteins in same PDB: d3th3h_, d3th3l2, d3th3t1, d3th3t2 automated match to d1danl1 complexed with 0ge, bgc, ca, cl, fuc |
PDB Entry: 3th3 (more details), 2.7 Å
SCOPe Domain Sequences for d3th3l1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3th3l1 g.3.11.0 (L:47-86) automated matches {Human (Homo sapiens) [TaxId: 9606]} gdqcasspcqnggsckdqlqsyicfclpafegrncethkd
Timeline for d3th3l1: