SCOPe 2.08: Domain d3th3l1: 3th3 L:47-86

Lineage for d3th3l1 (3th3 L:47-86)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
   disulfide-bound fold; contains beta-hairpin with two adjacent disulfides

4. Superfamily g.3.11: EGF/Laminin [57196] (8 families)

5. Family g.3.11.0: automated matches [227227] (1 protein)
   not a true family

6. Protein automated matches [226968] (5 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [225423] (30 PDB entries)

8. Domain d3th3l1: 3th3 L:47-86 [233679]
   Other proteins in same PDB: d3th3h_, d3th3l2, d3th3t1, d3th3t2
   automated match to d1danl1
   complexed with 0ge, bgc, ca, cl, fuc

Details for d3th3l1

PDB Entry: 3th3, 2.7 Å

PDB Description: mg2+ is required for optimal folding of the gamma-carboxyglutamic acid (gla) domains of vitamin k-dependent clotting factors at physiological ca2+

PDB Compounds: (L:) Coagulation factor VII light chain

SCOPe Domain Sequences for d3th3l1:

Sequence; same for both SEQRES and ATOM records:

>d3th3l1 g.3.11.0 (L:47-86) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gdqcasspcqnggsckdqlqsyicfclpafegrncethkd

Timeline for d3th3l1:

• d3th3l1 first appeared in SCOPe 2.03
  
• d3th3l1 appears in SCOPe 2.07