Lineage for d3stjd1 (3stj D:11-236)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1545310Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 1545311Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 1547699Family b.47.1.0: automated matches [191364] (1 protein)
    not a true family
  6. 1547700Protein automated matches [190438] (19 species)
    not a true protein
  7. 1547706Species Escherichia coli K-12 [TaxId:83333] [226179] (2 PDB entries)
  8. 1547710Domain d3stjd1: 3stj D:11-236 [233629]
    Other proteins in same PDB: d3stja2, d3stjb2, d3stjc2, d3stjd2, d3stje2, d3stjf2, d3stjg2, d3stjh2, d3stji2, d3stjj2, d3stjk2, d3stjl2
    automated match to d1ky9a2

Details for d3stjd1

PDB Entry: 3stj (more details), 2.6 Å

PDB Description: Crystal structure of the protease + PDZ1 domain of DegQ from Escherichia coli
PDB Compounds: (D:) Protease degQ

SCOPe Domain Sequences for d3stjd1:

Sequence, based on SEQRES records: (download)

>d3stjd1 b.47.1.0 (D:11-236) automated matches {Escherichia coli K-12 [TaxId: 83333]}
plpslapmlekvlpavvsvrvegtasqgqkipeefkkffgddlpdqpaqpfeglgsgvii
naskgyvltnnhvinqaqkisiqlndgrefdakligsddqsdiallqiqnpskltqiaia
dsdklrvgdfavavgnpfglgqtatsgivsalgrsglnleglenfiqtdasinrgnsgga
llnlngeligintailapgggsvgigfaipsnmartlaqqlidfge

Sequence, based on observed residues (ATOM records): (download)

>d3stjd1 b.47.1.0 (D:11-236) automated matches {Escherichia coli K-12 [TaxId: 83333]}
plpslapmlekvlpavvsvrvegtqpfeglgsgviinaskgyvltnnhvinqaqkisiql
ndgrefdakligsddqsdiallqiqnpskltqiaiadsdklrvgdfavavgnpfglgqta
tsgivsalgrsglnleglenfiqtdasinrgnsggallnlngeligintailapgggsvg
igfaipsnmartlaqqlidfge

SCOPe Domain Coordinates for d3stjd1:

Click to download the PDB-style file with coordinates for d3stjd1.
(The format of our PDB-style files is described here.)

Timeline for d3stjd1: