Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) binds metal ion (magnesium or manganese) in conserved site inside barrel N-terminal alpha+beta domain is common to this superfamily |
Family c.1.11.0: automated matches [227196] (1 protein) not a true family |
Protein automated matches [226923] (78 species) not a true protein |
Species Shewanella pealeana [TaxId:398579] [233539] (1 PDB entry) |
Domain d3sjnb2: 3sjn B:129-373 [233541] Other proteins in same PDB: d3sjna1, d3sjna3, d3sjnb1, d3sjnb3 automated match to d2poza2 complexed with gol, mg, unl |
PDB Entry: 3sjn (more details), 1.9 Å
SCOPe Domain Sequences for d3sjnb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3sjnb2 c.1.11.0 (B:129-373) automated matches {Shewanella pealeana [TaxId: 398579]} kyrdkircygtfipadkpednvaivqglkdqgfssikfgggvmgddpdtdyaivkavrea agpemevqidlaskwhtcghsammakrleefnlnwieepvladslisyeklsrqvsqkia ggeslttryefqefitksnadivqpditrcggitemkkiydiaqmngtqliphgfstgil lhasvhflaaceqgtlmefsqsssplftslvknqlqfdngfvavsdapglgieldeelia kyrvn
Timeline for d3sjnb2: