SCOPe 2.04: Domain d3sfjc_: 3sfj C:

Lineage for d3sfjc_ (3sfj C:)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.36: PDZ domain-like [50155] (1 superfamily)
   contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix

4. Superfamily b.36.1: PDZ domain-like [50156] (7 families)
   peptide-binding domain

5. Family b.36.1.0: automated matches [191362] (1 protein)
   not a true family

6. Protein automated matches [190436] (5 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187333] (75 PDB entries)

8. Domain d3sfjc_: 3sfj C: [233531]
   automated match to d3dj3b_

Details for d3sfjc_

PDB Entry: 3sfj, 1.24 Å

PDB Description: Crystal Structure of Tax-Interacting Protein-1 (TIP-1) PDZ domain bound to iCAL36 inhibitor peptide

PDB Compounds: (C:) tax1-binding protein 3

SCOPe Domain Sequences for d3sfjc_:

Sequence; same for both SEQRES and ATOM records:

>d3sfjc_ b.36.1.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vtavvqrveihklrqgenlilgfsigggidqdpsqnpfsedktdkgiyvtrvseggpaei
aglqigdkimqvngwdmtmvthdqarkrltkrseevvrllvtrq

Timeline for d3sfjc_:

• d3sfjc_ first appeared in SCOPe 2.03
  
• d3sfjc_ appears in SCOPe 2.05
  
• d3sfjc_ appears in the current release, SCOPe 2.08, called d3sfjc1