Class b: All beta proteins [48724] (178 folds) |
Fold b.42: beta-Trefoil [50352] (8 superfamilies) barrel, closed; n=6, S=12; and a hairpin triplet; meander duplication: has internal pseudo threefold symmetry |
Superfamily b.42.4: STI-like [50386] (3 families) |
Family b.42.4.0: automated matches [191368] (1 protein) not a true family |
Protein automated matches [190445] (10 species) not a true protein |
Species Clostridium botulinum [TaxId:1491] [225676] (22 PDB entries) |
Domain d3r4sa2: 3r4s A:1094-1291 [233392] Other proteins in same PDB: d3r4sa1, d3r4sa3, d3r4sb1, d3r4sb3 automated match to d3btaa2 complexed with sia, slb |
PDB Entry: 3r4s (more details), 2.15 Å
SCOPe Domain Sequences for d3r4sa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3r4sa2 b.42.4.0 (A:1094-1291) automated matches {Clostridium botulinum [TaxId: 1491]} ytnvvkdywgndlrynkeyymvnidylnrymyansrqivfntrrnnndfnegykiiikri rgntndtrvrggdilyfdmtinnkaynlfmknetmyadnhstediyaiglreqtkdindn iifqiqpmnntyyyasqifksnfngenisgicsigtyrfrlggdwyrhnylvptvkqgny aslleststhwgfvpvse
Timeline for d3r4sa2: