Lineage for d3qgya_ (3qgy A:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1433536Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 1433537Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 1433619Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 1435504Protein Tyrosine-protein kinase Itk/Tsk [111194] (1 species)
    PTK group; Tec/Atk subfamily; non-membrane spanning protein tyrosine kinase
  7. 1435505Species Human (Homo sapiens) [TaxId:9606] [111195] (26 PDB entries)
    Uniprot Q08881 357-619
  8. 1435529Domain d3qgya_: 3qgy A: [233326]
    automated match to d4kioc_
    complexed with l7o, pqc

Details for d3qgya_

PDB Entry: 3qgy (more details), 2.1 Å

PDB Description: Crystal structure of ITK inhibitor complex
PDB Compounds: (A:) Tyrosine-protein kinase ITK/TSK

SCOPe Domain Sequences for d3qgya_:

Sequence, based on SEQRES records: (download)

>d3qgya_ d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Human (Homo sapiens) [TaxId: 9606]}
hmvidpseltfvqeigsgqfglvhlgywlnkdkvaiktikegsmseddfieeaevmmkls
hpklvqlygvcleqapiclvfefmehgclsdylrtqrglfaaetllgmcldvcegmayle
eacvihrdlaarnclvgenqvikvsdfgmtrfvlddqytsstgtkfpvkwaspevfsfsr
yssksdvwsfgvlmwevfsegkipyenrsnsevvedistgfrlykprlasthvyqimnhc
wkerpedrpafsrllrqlaeiaes

Sequence, based on observed residues (ATOM records): (download)

>d3qgya_ d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Human (Homo sapiens) [TaxId: 9606]}
hmvidpseltfvqeigsgqfglvhlgywlnkdkvaiktikegsmseddfieeaevmmkls
hpklvqlygvcleqapiclvfefmehgclsdylrtqrglfaaetllgmcldvcegmayle
eacvihrdlaarnclvgenqvikvsdfgpvkwaspevfsfsryssksdvwsfgvlmwevf
segkipyenrsnsevvedistgfrlykprlasthvyqimnhcwkerpedrpafsrllrql
aeiaes

SCOPe Domain Coordinates for d3qgya_:

Click to download the PDB-style file with coordinates for d3qgya_.
(The format of our PDB-style files is described here.)

Timeline for d3qgya_:

  • d3qgya_ appears in periodic updates to SCOPe 2.03 starting on 2014-01-12
  • d3qgya_ appears in SCOPe 2.04
  • d3qgya_ appears in the current release, SCOPe 2.07, called d3qgya1