SCOPe 2.07: Domain d3pwia1: 3pwi A:7-137

Lineage for d3pwia1 (3pwi A:7-137)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
   beta(3)-alpha(3); meander and up-and-down bundle

4. Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families)

5. Family d.54.1.0: automated matches [227195] (1 protein)
   not a true family

6. Protein automated matches [226922] (94 species)
   not a true protein

7. Species Escherichia coli [TaxId:444449] [233278] (2 PDB entries)

8. Domain d3pwia1: 3pwi A:7-137 [233288]
   Other proteins in same PDB: d3pwia2, d3pwib2
   automated match to d1ec7a2
   complexed with glr, gol, mg; mutant

Details for d3pwia1

PDB Entry: 3pwi, 2.23 Å

PDB Description: Crystal structure of the mutant P34A of D-Glucarate dehydratase from Escherichia coli complexed with product 5-keto-4-deoxy-D-Glucarate

PDB Compounds: (A:) glucarate dehydratase

SCOPe Domain Sequences for d3pwia1:

Sequence; same for both SEQRES and ATOM records:

>d3pwia1 d.54.1.0 (A:7-137) automated matches {Escherichia coli [TaxId: 444449]}
tpvvtemqvipvaghdsmlmnlsgahaafftrniviikdnsghtgvgeipggekirktle
daiplvvgktlgeyknvltlvrntfadrdaggrglqtfdlrttihvvtgieaamldllgq
hlgvnvasllg

Timeline for d3pwia1:

• d3pwia1 first appeared in SCOPe 2.03
  
• d3pwia1 appears in SCOPe 2.06
  
• d3pwia1 appears in the current release, SCOPe 2.08