Lineage for d3pmea1 (3pme A:868-1085)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2387948Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2387949Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2390272Family b.29.1.0: automated matches [191363] (1 protein)
    not a true family
  6. 2390273Protein automated matches [190437] (66 species)
    not a true protein
  7. 2390422Species Clostridium botulinum [TaxId:1491] [225675] (24 PDB entries)
  8. 2390423Domain d3pmea1: 3pme A:868-1085 [233258]
    Other proteins in same PDB: d3pmea2, d3pmea3
    automated match to d3btaa1
    complexed with gol, so4

Details for d3pmea1

PDB Entry: 3pme (more details), 1.56 Å

PDB Description: Crystal structure of the receptor binding domain of botulinum neurotoxin C/D mosaic serotype
PDB Compounds: (A:) Type C neurotoxin

SCOPe Domain Sequences for d3pmea1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3pmea1 b.29.1.0 (A:868-1085) automated matches {Clostridium botulinum [TaxId: 1491]}
indskilslqnkknalvdtsgynaevrlegdvqvntiytndfklsssgdkiivnlnnnil
ysaiyenssvsfwikiskdltnshneytiinsikqnsgwklcirngniewilqdinrkyk
slifdyseslshtgytnkwffvtitnnimgymklyingelkqseriedldevkldktivf
gidenidenqmlwirdfnifskelsnedinivyegqil

SCOPe Domain Coordinates for d3pmea1:

Click to download the PDB-style file with coordinates for d3pmea1.
(The format of our PDB-style files is described here.)

Timeline for d3pmea1: