Lineage for d3p6aa2 (3p6a A:624-765)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1323359Fold b.55: PH domain-like barrel [50728] (2 superfamilies)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 1323360Superfamily b.55.1: PH domain-like [50729] (14 families) (S)
  5. 1323920Family b.55.1.0: automated matches [191311] (1 protein)
    not a true family
  6. 1323921Protein automated matches [190052] (4 species)
    not a true protein
  7. 1323936Species Human (Homo sapiens) [TaxId:9606] [186914] (10 PDB entries)
  8. 1323947Domain d3p6aa2: 3p6a A:624-765 [233181]
    Other proteins in same PDB: d3p6aa1, d3p6ab1
    automated match to d1xcga2
    mutant

Details for d3p6aa2

PDB Entry: 3p6a (more details), 2.5 Å

PDB Description: Crystal Structure of the DH/PH domains of p115-RhoGEF (R399E mutant)
PDB Compounds: (A:) Rho guanine nucleotide exchange factor 1

SCOPe Domain Sequences for d3p6aa2:

Sequence, based on SEQRES records: (download)

>d3p6aa2 b.55.1.0 (A:624-765) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lshlrqssdpmlsefknlditkkklvhegpltwrvtkdkavevhvlllddlllllqrqde
rlllkshsrtltptpdgktmlrpvlrltsamtrevatdhkafyvlftwdqeaqiyelvaq
tvserknwcalitetagslkvp

Sequence, based on observed residues (ATOM records): (download)

>d3p6aa2 b.55.1.0 (A:624-765) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lshlrqssdpmlsefknlditkkklvhegpltwrvtkdkavevhvlllddlllllqrqde
rlllkshsrtmlrpvlrltsamtrevatdhkafyvlftwdqeaqiyelvaqtvserknwc
alitetagslkvp

SCOPe Domain Coordinates for d3p6aa2:

Click to download the PDB-style file with coordinates for d3p6aa2.
(The format of our PDB-style files is described here.)

Timeline for d3p6aa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3p6aa1