Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily) beta(3)-alpha(3); meander and up-and-down bundle |
Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) |
Family d.54.1.0: automated matches [227195] (1 protein) not a true family |
Protein automated matches [226922] (94 species) not a true protein |
Species Actinobacillus succinogenes [TaxId:339671] [225929] (4 PDB entries) |
Domain d3n6ja1: 3n6j A:6-138 [232981] Other proteins in same PDB: d3n6ja2, d3n6jb2, d3n6jb3, d3n6jc2, d3n6jd2 automated match to d4g8ta1 |
PDB Entry: 3n6j (more details), 2.4 Å
SCOPe Domain Sequences for d3n6ja1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3n6ja1 d.54.1.0 (A:6-138) automated matches {Actinobacillus succinogenes [TaxId: 339671]} qsvpvitdmkvipvaghdsmlmnvggahspyftrniviltdnsghtgvgeapggatiena lteaiphvvgrpisilnkivndmhngyldadydtfgkgawtfelrvnavaaleaalldlm gqflgvpvaellg
Timeline for d3n6ja1: