SCOPe 2.07: Domain d3n6hc1: 3n6h C:7-138

Lineage for d3n6hc1 (3n6h C:7-138)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
   beta(3)-alpha(3); meander and up-and-down bundle

4. Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families)

5. Family d.54.1.0: automated matches [227195] (1 protein)
   not a true family

6. Protein automated matches [226922] (94 species)
   not a true protein

7. Species Actinobacillus succinogenes [TaxId:339671] [225929] (4 PDB entries)

8. Domain d3n6hc1: 3n6h C:7-138 [232977]
   Other proteins in same PDB: d3n6ha2, d3n6ha3, d3n6hb2, d3n6hb3, d3n6hc2, d3n6hd2, d3n6hd3
   automated match to d4g8ta1
   complexed with cl, mg, so4

Details for d3n6hc1

PDB Entry: 3n6h, 2.3 Å

PDB Description: crystal structure of mandelate racemase/muconate lactonizing protein from actinobacillus succinogenes 130z complexed with magnesium/sulfate

PDB Compounds: (C:) Mandelate racemase/muconate lactonizing protein

SCOPe Domain Sequences for d3n6hc1:

Sequence, based on SEQRES records:

>d3n6hc1 d.54.1.0 (C:7-138) automated matches {Actinobacillus succinogenes [TaxId: 339671]}
svpvitdmkvipvaghdsmlmnvggahspyftrniviltdnsghtgvgeapggatienal
teaiphvvgrpisilnkivndmhngyldadydtfgkgawtfelrvnavaaleaalldlmg
qflgvpvaellg

Sequence, based on observed residues (ATOM records):

>d3n6hc1 d.54.1.0 (C:7-138) automated matches {Actinobacillus succinogenes [TaxId: 339671]}
svpvitdmkvipvaghdsmlmnvggahspyftrniviltdnsghtgvgeapggatienal
teaiphvvgrpisilnkivndmhntfelrvnavaaleaalldlmgqflgvpvaellg

Timeline for d3n6hc1:

• d3n6hc1 first appeared in SCOPe 2.03
  
• d3n6hc1 appears in SCOPe 2.06
  
• d3n6hc1 appears in the current release, SCOPe 2.08