Lineage for d3l71o2 (3l71 O:236-439)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3005156Fold d.185: LuxS/MPP-like metallohydrolase [63410] (1 superfamily)
    core: beta-alpha-beta(2)-alpha(2); 2 layers: alpha/beta
  4. 3005157Superfamily d.185.1: LuxS/MPP-like metallohydrolase [63411] (3 families) (S)
    Share the same "active site motif" HxxEH located in the first core helix, but differ in one of the zinc-binding residues
  5. 3005465Family d.185.1.0: automated matches [232765] (1 protein)
    not a true family
  6. 3005466Protein automated matches [232766] (2 species)
    not a true protein
  7. 3005467Species Chicken (Gallus gallus) [TaxId:9031] [232768] (8 PDB entries)
  8. 3005498Domain d3l71o2: 3l71 O:236-439 [232800]
    Other proteins in same PDB: d3l71c1, d3l71c2, d3l71d1, d3l71d2, d3l71e1, d3l71e2, d3l71f_, d3l71g_, d3l71h_, d3l71j_, d3l71p1, d3l71p2, d3l71q1, d3l71q2, d3l71r1, d3l71r2, d3l71s_, d3l71t_, d3l71u_, d3l71w_
    automated match to d1ppjb2
    complexed with azo, bog, cdl, fes, gol, hec, hem, pee, uq

Details for d3l71o2

PDB Entry: 3l71 (more details), 2.84 Å

PDB Description: cytochrome bc1 complex from chicken with azoxystrobin bound
PDB Compounds: (O:) Mitochondrial ubiquinol-cytochrome-c reductase complex core protein 2

SCOPe Domain Sequences for d3l71o2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3l71o2 d.185.1.0 (O:236-439) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
katywggeireqnghslvhaavvtegaavgsaeanafsvlqhvlgagplikrgssvtskl
yqgvakattqpfdasafnvnysdsglfgfytisqaahageviraamnqlkaaaqggvtee
dvtkaknqlkatylmsvetaqgllneigseallsgthtapsvvaqkidsvtsadvvnaak
kfvsgkksmaasgdlgstpfldel

SCOPe Domain Coordinates for d3l71o2:

Click to download the PDB-style file with coordinates for d3l71o2.
(The format of our PDB-style files is described here.)

Timeline for d3l71o2: