SCOPe 2.03: Domain d3k7ib_: 3k7i B:

Lineage for d3k7ib_ (3k7i B:)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.65: Hedgehog/DD-peptidase [55165] (1 superfamily)
   alpha-beta(2)-alpha-beta(2); 2 layers: alpha/beta

4. Superfamily d.65.1: Hedgehog/DD-peptidase [55166] (5 families)
   zinc-binding motif

5. Family d.65.1.2: Hedgehog (development protein), N-terminal signaling domain [55170] (3 proteins)
   automatically mapped to Pfam PF01085

6. Protein automated matches [190324] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188953] (15 PDB entries)

8. Domain d3k7ib_: 3k7i B: [232677]
   automated match to d1vhha_
   complexed with so4, zn; mutant

Details for d3k7ib_

PDB Entry: 3k7i, 1.44 Å

PDB Description: Crystal structure of the E131K mutant of the Indian Hedgehog N-terminal signalling domain

PDB Compounds: (B:) Indian hedgehog protein

SCOPe Domain Sequences for d3k7ib_:

Sequence; same for both SEQRES and ATOM records:

>d3k7ib_ d.65.1.2 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
prklvplaykqfspnvpektlgasgryegkiarsserfkeltpnynpdiifkdeentgad
rlmtqrckdrlnslaisvmnqwpgvklrvtkgwdedghhseeslhyegravdittsdrdr
nkygllarlaveagfdwvyyeskahvhcsvksehsaa

Timeline for d3k7ib_:

• d3k7ib_ is new in SCOPe 2.03-stable
  
• d3k7ib_ appears in SCOPe 2.04
  
• d3k7ib_ appears in the current release, SCOPe 2.08