Class a: All alpha proteins [46456] (289 folds) |
Fold a.45: GST C-terminal domain-like [47615] (1 superfamily) core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix |
Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) this domains follows the thioredoxin-like N-terminal domain |
Family a.45.1.0: automated matches [227130] (1 protein) not a true family |
Protein automated matches [226831] (71 species) not a true protein |
Species Escherichia coli K-12 [TaxId:83333] [232348] (2 PDB entries) |
Domain d3gx0a2: 3gx0 A:86-204 [232349] Other proteins in same PDB: d3gx0a1 automated match to d4ecib2 complexed with gds |
PDB Entry: 3gx0 (more details), 2.3 Å
SCOPe Domain Sequences for d3gx0a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3gx0a2 a.45.1.0 (A:86-204) automated matches {Escherichia coli K-12 [TaxId: 83333]} flshetreraatlqwlfwqvgglgpmlgqnhhfnhaapqtipyaieryqvetqrlyhvln krlenspwlggenysiadiacwpwvnawtrqridlamypavknwherirsrpatgqall
Timeline for d3gx0a2: