Lineage for d3gx0a2 (3gx0 A:86-204)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2325989Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 2325990Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 2326952Family a.45.1.0: automated matches [227130] (1 protein)
    not a true family
  6. 2326953Protein automated matches [226831] (71 species)
    not a true protein
  7. 2327083Species Escherichia coli K-12 [TaxId:83333] [232348] (2 PDB entries)
  8. 2327085Domain d3gx0a2: 3gx0 A:86-204 [232349]
    Other proteins in same PDB: d3gx0a1
    automated match to d4ecib2
    complexed with gds

Details for d3gx0a2

PDB Entry: 3gx0 (more details), 2.3 Å

PDB Description: Crystal Structure of GSH-dependent Disulfide bond Oxidoreductase
PDB Compounds: (A:) GST-like protein yfcG

SCOPe Domain Sequences for d3gx0a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3gx0a2 a.45.1.0 (A:86-204) automated matches {Escherichia coli K-12 [TaxId: 83333]}
flshetreraatlqwlfwqvgglgpmlgqnhhfnhaapqtipyaieryqvetqrlyhvln
krlenspwlggenysiadiacwpwvnawtrqridlamypavknwherirsrpatgqall

SCOPe Domain Coordinates for d3gx0a2:

Click to download the PDB-style file with coordinates for d3gx0a2.
(The format of our PDB-style files is described here.)

Timeline for d3gx0a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3gx0a1