Lineage for d3g7nb_ (3g7n B:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2507025Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2507026Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2509433Family c.69.1.0: automated matches [191404] (1 protein)
    not a true family
  6. 2509434Protein automated matches [190543] (124 species)
    not a true protein
  7. 2510143Species Penicillium expansum [TaxId:27334] [232252] (1 PDB entry)
  8. 2510145Domain d3g7nb_: 3g7n B: [232254]
    automated match to d1tiba_
    complexed with 1pe, peg, so4

Details for d3g7nb_

PDB Entry: 3g7n (more details), 1.3 Å

PDB Description: crystal structure of a triacylglycerol lipase from penicillium expansum at 1.3
PDB Compounds: (B:) Lipase

SCOPe Domain Sequences for d3g7nb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3g7nb_ c.69.1.0 (B:) automated matches {Penicillium expansum [TaxId: 27334]}
atadaaafpdlhraaklssaaytgcigkafdvtivkriydlvtdtngfvgystekktiav
imrgsttitdfvndidialitpelsgvtfpsdvkimrgvhrpwsavhdtiitevkaliak
ypdytleavghslggaltsiahvalaqnfpdkslvsnalnafpignqawadfgtaqagtf
nrgnnvldgvpnmyssplvnfkhygteyyssgteastvkcegqrdkscsagngmyavtpg
hiasfgvvmltagcgyl

SCOPe Domain Coordinates for d3g7nb_:

Click to download the PDB-style file with coordinates for d3g7nb_.
(The format of our PDB-style files is described here.)

Timeline for d3g7nb_: