SCOPe 2.04: Domain d3g1ma1: 3g1m A:22-94

Lineage for d3g1ma1 (3g1m A:22-94)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.1: Homeodomain-like [46689] (20 families)
   consists only of helices

5. Family a.4.1.0: automated matches [191447] (1 protein)
   not a true family

6. Protein automated matches [190674] (14 species)
   not a true protein

7. Species Mycobacterium tuberculosis [TaxId:1773] [232223] (12 PDB entries)

8. Domain d3g1ma1: 3g1m A:22-94 [232225]
   Other proteins in same PDB: d3g1ma2
   automated match to d1t56a1
   protein/DNA complex; complexed with rf3

Details for d3g1ma1

PDB Entry: 3g1m, 1.7 Å

PDB Description: EthR from Mycobacterium tuberculosis in complex with compound BDM31381

PDB Compounds: (A:) transcriptional regulatory repressor protein (tetr-family) ethr

SCOPe Domain Sequences for d3g1ma1:

Sequence; same for both SEQRES and ATOM records:

>d3g1ma1 a.4.1.0 (A:22-94) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
gddrelailataenlledrpladisvddlakgagisrptfyfyfpskeavlltlldrvvn
qadmalqtlaenp

Timeline for d3g1ma1:

• d3g1ma1 first appeared in SCOPe 2.03
  
• d3g1ma1 appears in SCOPe 2.05
  
• d3g1ma1 appears in the current release, SCOPe 2.08