SCOPe 2.07: Domain d3g00b_: 3g00 B:

Lineage for d3g00b_ (3g00 B:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.151: DNase I-like [56218] (1 superfamily)
   contains beta-sandwich; duplication of alpha+beta motif

4. Superfamily d.151.1: DNase I-like [56219] (4 families)

5. Family d.151.1.0: automated matches [191468] (1 protein)
   not a true family

6. Protein automated matches [190734] (14 species)
   not a true protein

7. Species Methanothermobacter thermautotrophicus [TaxId:187420] [229730] (15 PDB entries)

8. Domain d3g00b_: 3g00 B: [232218]
   Other proteins in same PDB: d3g00a2
   automated match to d2jc5a_
   protein/DNA complex; complexed with gol, mpd, po4

Details for d3g00b_

PDB Entry: 3g00, 1.74 Å

PDB Description: Mth0212 in complex with a 9bp blunt end dsDNA at 1.7 Angstrom

PDB Compounds: (B:) exodeoxyribonuclease

SCOPe Domain Sequences for d3g00b_:

Sequence; same for both SEQRES and ATOM records:

>d3g00b_ d.151.1.0 (B:) automated matches {Methanothermobacter thermautotrophicus [TaxId: 187420]}
vlkiiswnvnglravhrkgflkwfmeekpdilclqeikaapeqlprklrhvegyrsfftp
aerkgysgvamytkvppsslregfgverfdtegriqiadfddfllyniyfpngkmseerl
kyklefydafledvnrerdsgrnviicgnfntahreidlarpkensnvsgflpverawid
kfiengyvdtfrmfnsdpgqytwwsyrtrarernvgwrldyffvneefkgkvkrswilsd
vmgsdhcpigleiel

Timeline for d3g00b_:

• d3g00b_ first appeared in SCOPe 2.03
  
• d3g00b_ appears in SCOPe 2.06
  
• d3g00b_ appears in the current release, SCOPe 2.08