Lineage for d3bx2b_ (3bx2 B:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2338494Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2338495Superfamily a.118.1: ARM repeat [48371] (27 families) (S)
  5. 2339141Family a.118.1.0: automated matches [191340] (1 protein)
    not a true family
  6. 2339142Protein automated matches [190220] (14 species)
    not a true protein
  7. 2339153Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [186980] (5 PDB entries)
  8. 2339160Domain d3bx2b_: 3bx2 B: [231868]
    automated match to d3q0mb_
    protein/RNA complex; complexed with na, so4

Details for d3bx2b_

PDB Entry: 3bx2 (more details), 2.84 Å

PDB Description: Puf4 RNA binding domain bound to HO endonuclease RNA 3' UTR recognition sequence
PDB Compounds: (B:) Protein PUF4

SCOPe Domain Sequences for d3bx2b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bx2b_ a.118.1.0 (B:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
dqyigsihslckdqhgcrflqkqldilgskaadaifeetkdytvelmtdsfgnyliqkll
eevtteqrivltkissphfveislnphgtralqklieciktdeeaqivvdslrpytvqls
kdlngnhviqkclqrlkpenfqfifdaisdscidiathrhgccvlqrcldhgtteqcdnl
cdkllalvdkltldpfgnyvvqyiitkeaeknkydythkivhllkpraielsihkfgsnv
iekilktaivsepmileilnnggetgiqsllndsygnyvlqtaldishkqndylykrlse
ivapllvgpirntphgkriigml

SCOPe Domain Coordinates for d3bx2b_:

Click to download the PDB-style file with coordinates for d3bx2b_.
(The format of our PDB-style files is described here.)

Timeline for d3bx2b_: