Lineage for d3bjsb1 (3bjs B:37-165)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2554471Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 2554472Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) (S)
  5. 2554768Family d.54.1.0: automated matches [227195] (1 protein)
    not a true family
  6. 2554769Protein automated matches [226922] (94 species)
    not a true protein
  7. 2555321Species Polaromonas sp. [TaxId:296591] [231854] (1 PDB entry)
  8. 2555323Domain d3bjsb1: 3bjs B:37-165 [231858]
    Other proteins in same PDB: d3bjsa2, d3bjsb2
    automated match to d2o56a1
    complexed with mg

Details for d3bjsb1

PDB Entry: 3bjs (more details), 2.7 Å

PDB Description: crystal structure of a member of enolase superfamily from polaromonas sp. js666
PDB Compounds: (B:) Mandelate racemase/muconate lactonizing enzyme

SCOPe Domain Sequences for d3bjsb1:

Sequence, based on SEQRES records: (download)

>d3bjsb1 d.54.1.0 (B:37-165) automated matches {Polaromonas sp. [TaxId: 296591]}
mkitkinaiplsyrlpegktvtmgvgstikrdaiiirvetsegitgygeahpgrspgait
slihntiapmligmkatdcvgawqrvhrmqlsshglgagaalaisgidmalwdirgkaan
mplyellgg

Sequence, based on observed residues (ATOM records): (download)

>d3bjsb1 d.54.1.0 (B:37-165) automated matches {Polaromonas sp. [TaxId: 296591]}
mkitkinaiplsyrlptvtmgvgstikrdaiiirvetsegitgygeahpgrspgaitsli
hntiapmligmkatdcvgawqrvhrmqlsshglgagaalaisgidmalwdirgkaanmpl
yellgg

SCOPe Domain Coordinates for d3bjsb1:

Click to download the PDB-style file with coordinates for d3bjsb1.
(The format of our PDB-style files is described here.)

Timeline for d3bjsb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3bjsb2