Lineage for d3b76b_ (3b76 B:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1538457Fold b.36: PDZ domain-like [50155] (1 superfamily)
    contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix
  4. 1538458Superfamily b.36.1: PDZ domain-like [50156] (7 families) (S)
    peptide-binding domain
  5. 1538962Family b.36.1.0: automated matches [191362] (1 protein)
    not a true family
  6. 1538963Protein automated matches [190436] (5 species)
    not a true protein
  7. 1538977Species Human (Homo sapiens) [TaxId:9606] [187333] (75 PDB entries)
  8. 1539029Domain d3b76b_: 3b76 B: [231834]
    automated match to d2vrfa_
    complexed with edo, na

Details for d3b76b_

PDB Entry: 3b76 (more details), 1.75 Å

PDB Description: crystal structure of the third pdz domain of human ligand-of-numb protein-x (lnx1) in complex with the c-terminal peptide from the coxsackievirus and adenovirus receptor
PDB Compounds: (B:) E3 ubiquitin-protein ligase LNX

SCOPe Domain Sequences for d3b76b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3b76b_ b.36.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nlyfqsmhekvvniqkdpgeslgmtvaggashrewdlpiyvisvepggvisrdgriktgd
illnvdgveltevsrseavallkrtsssivlkalevkegsiv

SCOPe Domain Coordinates for d3b76b_:

Click to download the PDB-style file with coordinates for d3b76b_.
(The format of our PDB-style files is described here.)

Timeline for d3b76b_: