Lineage for d3aizd2 (3aiz D:127-245)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1669824Fold d.131: DNA clamp [55978] (1 superfamily)
    contains two helices and two beta sheets
    duplication: fold has internal pseudo two-fold symmetry
  4. 1669825Superfamily d.131.1: DNA clamp [55979] (3 families) (S)
  5. 1670188Family d.131.1.0: automated matches [227185] (1 protein)
    not a true family
  6. 1670189Protein automated matches [226907] (12 species)
    not a true protein
  7. 1670274Species Sulfolobus tokodaii [TaxId:273063] [231791] (2 PDB entries)
  8. 1670280Domain d3aizd2: 3aiz D:127-245 [231804]
    automated match to d2hiiy2
    complexed with so4

Details for d3aizd2

PDB Entry: 3aiz (more details), 2.8 Å

PDB Description: Crystal structure of PCNA2-PCNA3 complex from Sulfolobus tokodaii (P21212)
PDB Compounds: (D:) DNA polymerase sliding clamp c

SCOPe Domain Sequences for d3aizd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3aizd2 d.131.1.0 (D:127-245) automated matches {Sulfolobus tokodaii [TaxId: 273063]}
efpfkakaltvtftdiideiediggdsitfkaeggklylsansdmgsstielstenggll
eseggdaesvygleyvvntskmrkpsdtveiafgsqiplklrynlpqggyadfyiapra

SCOPe Domain Coordinates for d3aizd2:

Click to download the PDB-style file with coordinates for d3aizd2.
(The format of our PDB-style files is described here.)

Timeline for d3aizd2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3aizd1