Lineage for d2zwyb2 (2zwy B:357-447)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2419799Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
    folded sheet; greek-key
  4. 2419800Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) (S)
    this domain is C-terminal to the catalytic beta/alpha barrel domain
  5. 2420422Family b.71.1.0: automated matches [227134] (1 protein)
    not a true family
  6. 2420423Protein automated matches [226835] (41 species)
    not a true protein
  7. 2420664Species Thermotoga maritima [TaxId:2336] [231746] (10 PDB entries)
  8. 2420670Domain d2zwyb2: 2zwy B:357-447 [231747]
    Other proteins in same PDB: d2zwya1, d2zwya3, d2zwyb1, d2zwyb3
    automated match to d1hl8a1

Details for d2zwyb2

PDB Entry: 2zwy (more details), 2.75 Å

PDB Description: alpha-L-fucosidase
PDB Compounds: (B:) Alpha-L-fucosidase, putative

SCOPe Domain Sequences for d2zwyb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zwyb2 b.71.1.0 (B:357-447) automated matches {Thermotoga maritima [TaxId: 2336]}
gtsvwerccaktedgteirftrkcnrifviflgiptgekiviedlnlsagtvrhfltger
lsfknvgknleitvpkklletdsitlvleav

SCOPe Domain Coordinates for d2zwyb2:

Click to download the PDB-style file with coordinates for d2zwyb2.
(The format of our PDB-style files is described here.)

Timeline for d2zwyb2: