SCOPe 2.03: Domain d2zvib2: 2zvi B:124-411

Lineage for d2zvib2 (2zvi B:124-411)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.14: RuBisCo, C-terminal domain [51649] (2 families)
   automatically mapped to Pfam PF00016

5. Family c.1.14.0: automated matches [227297] (1 protein)
   not a true family

6. Protein automated matches [227123] (6 species)
   not a true protein

7. Species Bacillus subtilis [TaxId:1423] [231736] (1 PDB entry)

8. Domain d2zvib2: 2zvi B:124-411 [231737]
   Other proteins in same PDB: d2zvia1, d2zvib1, d2zvic1, d2zvid1
   automated match to d4nasa2

Details for d2zvib2

PDB Entry: 2zvi, 2.3 Å

PDB Description: Crystal structure of 2,3-diketo-5-methylthiopentyl-1-phosphate enolase from Bacillus subtilis

PDB Compounds: (B:) 2,3-diketo-5-methylthiopentyl-1-phosphate enolase

SCOPe Domain Sequences for d2zvib2:

Sequence; same for both SEQRES and ATOM records:

>d2zvib2 c.1.14.0 (B:124-411) automated matches {Bacillus subtilis [TaxId: 1423]}
pgpkfgvygirkllgeferpllmsifkgvigrdlsdikeqlrqqalggvdlikddeiffe
tglapfetriaegkqilketyeqtghktlyavnltgrtadlkdkarraaelgadallfnv
faygldvmqglaedpeipvpimahpavsgaftsspfygfshalllgklnrycgadfslfp
spygsvalpradalaiheecvredafnqtfavpsagihpgmvpllmrdfgidhiinaggg
vhghpngaqgggrafraiidavleaqpidekaeqckdlklaldkwgka

Timeline for d2zvib2:

• d2zvib2 is new in SCOPe 2.03-stable
  
• d2zvib2 appears in SCOPe 2.04
  
• d2zvib2 appears in the current release, SCOPe 2.08